PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_33217_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 130aa    MW: 15504.9 Da    PI: 10.4616
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_33217_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding537.9e-173784148
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         +g+W +eEde+l+ +v  lG ++W++ a+  g++R++k+c++rw +yl
  cra_locus_33217_iso_1_len_389_ver_3 37 KGPWLEEEDERLIAVVSVLGQRRWDALAKASGLKRSGKSCRLRWMNYL 84
                                         79********************************************97 PP

2Myb_DNA-binding48.91.5e-1593130443
                                          S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
                      Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 
                                           T+eE+ l+++++kq+G++ W++Iar+++ gRt++++k++
  cra_locus_33217_iso_1_len_389_ver_3  93 ITAEEENLIIQLHKQWGNR-WSRIARRLP-GRTDNEIKNY 130
                                          59*****************.*********.********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.0313288IPR017930Myb domain
SuperFamilySSF466898.79E-2834130IPR009057Homeodomain-like
SMARTSM007178.4E-143686IPR001005SANT/Myb domain
PfamPF002496.1E-153784IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-223891IPR009057Homeodomain-like
CDDcd001673.72E-93984No hitNo description
PROSITE profilePS5129418.14389130IPR017930Myb domain
SMARTSM007173.2E-789130IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-2192130IPR009057Homeodomain-like
PfamPF002493.7E-1393130IPR001005SANT/Myb domain
CDDcd001675.65E-1094130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 130 aa     Download sequence    Send to blast
XLCHIVSCIR RIIPFPYKFI CKQIMEHQEL AMQELRKGPW LEEEDERLIA VVSVLGQRRW  60
DALAKASGLK RSGKSCRLRW MNYLRPNLKH GHITAEEENL IIQLHKQWGN RWSRIARRLP  120
GRTDNEIKNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-2734130196MYB PROTO-ONCOGENE PROTEIN
1h88_C7e-272813049150MYB PROTO-ONCOGENE PROTEIN
1h89_C7e-272813049150MYB PROTO-ONCOGENE PROTEIN
1h8a_C5e-272813018119MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00406DAPTransfer from AT3G53200Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010098805.14e-56Myb-related protein MYBAS1
SwissprotQ53NK62e-47MYBA1_ORYSJ; Myb-related protein MYBAS1
TrEMBLA0A068V3D21e-58A0A068V3D2_COFCA; Uncharacterized protein
STRINGSolyc09g008390.1.12e-53(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154